PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G238500.1.p
Common NameGLYMA_10G238500, LOC100809803
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 860aa    MW: 98358 Da    PI: 6.457
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G238500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR180.33.4e-2576162188
                 FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                          +fYn+YA+ +GF+vrk+  ++sk +g++++r+f+Cskeg+r+++k++  + +++r+etr gC a++ v+++ dgk++vt++e +HnH+
  Glyma.10G238500.1.p  76 QFYNKYARLLGFNVRKDWINRSKVHGQVVSRKFTCSKEGYRRKDKRD-ANVKKHRKETRSGCLAHMIVTRQPDGKYQVTHFEAQHNHD 162
                          6*******************************************999.99999**********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-2276162IPR004330FAR1 DNA binding domain
PfamPF105511.0E-23288382IPR018289MULE transposase domain
PROSITE profilePS5096610.41568604IPR007527Zinc finger, SWIM-type
SMARTSM005755.0E-5579606IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 860 aa     Download sequence    Send to blast
MDGDQNELGT VGEGNVDIGP QTLNNLDLNV EQNCCSSNVA HASDTQSCHP SSANVLSGDT  60
VLGIGTEFES DDHAYQFYNK YARLLGFNVR KDWINRSKVH GQVVSRKFTC SKEGYRRKDK  120
RDANVKKHRK ETRSGCLAHM IVTRQPDGKY QVTHFEAQHN HDNINSNSNS ANMLNLQNEF  180
SVAQAVEADS NNSLGPKSKS ALDVLNKKTS ARESLDLLSM NYDNYLHYAR ERDMKEGEAG  240
RLLGYFQRQH FENPTFFYAI QLDVDDKVSN IFWADDNMVV DYEHFGDVIC LDTTCRTNKD  300
LRPFVQFLGI NHHRQVLIFA AAFLYDDSIE SYNWLFRTFI SAMSGKKPKT ILTEQEAVII  360
EAINTVLSHT NHCTCVWQLY ENTLKHLSHV VKDAESFAND LRRSIYDPKD EEEFTHAWEA  420
MLEKYNLQQN EWLRWIYRER EKWAVVFGQN TFFVDIKGFH LGEILSKKFR NYLNPDLDVL  480
QFFKHFERVV DEQRYKEIEA SEEMSRCLPR LMGNVVLLKH ASDIYTPRTF EVFQRAYEKS  540
LNVLVNQHSR NGSLFEYKAN TFGHTRQYNV TFNSSDDTVV CSCMKFERVG ILCSHALKVL  600
DHRNIKVVPS RYILDRWTGH ARLGNLREIR QCKMQDNPNM VVTSCYKDLC NRLLKLSARA  660
SESMEAYQFA ARQLDEVMIG VEKILTLKVE QRQVITSSNI DANASENEPA EIFLNGHSIE  720
DQDESNRANG GKDRRATSDR GYLTTMTCNG ADSDRILNVE VSPPNTVVCI SSPSSAYVSS  780
HSATPNPILQ GLYGFEANQV VHCMYEQSNR VLDHQSNSNT LQPPNIFSNQ QDSPGQSQLL  840
QEPIIQSTYH ASMLSNNQM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.217970.0flower| hypocotyl| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014618844.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLI1LDU20.0I1LDU2_SOYBN; Uncharacterized protein
STRINGGLYMA10G38320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-104FAR1-related sequence 5